FAM82A Rabbit Polyclonal Antibody

SKU: orb325781

Description

FAM82A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RMDN2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human FAM82A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM82A
• Target: RMDN2
• Protein Sequence: Synthetic peptide located within the following region: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV
• Molecular Weight: 65kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti BLOCK18 antibody, anti FLJ32954 antibody, anti FLJ38143 antibody, anti MGC33318 antibody, anti PRO34163 antibody, anti PYST9371 antibody, anti RMD2 antibody, anti RMD4 antibody, anti RMD-2 antibody, anti FAM82A antibody

Quick Database Links

Gene Symbol

RMDN2

UniProt

Q96LZ7

RefSeq (Protein):NP_653314