You have no items in your shopping cart.
Cart summary
Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc)
Catalog Number: orb1976404
| Catalog Number | orb1976404 |
|---|---|
| Category | Proteins |
| Description | With S4 and S12 plays an important role in translational accuracy.; Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body. Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 24.8 kDa and the accession number is A6QJ75. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 24.8 kDa (predicted) |
| UniProt ID | A6QJ75 |
| Protein Sequence | MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE |
| Expression System | E. coli |
| Biological Origin | Staphylococcus aureus |
| Biological Activity | With S4 and S12 plays an important role in translational accuracy.; Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body. Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 24.8 kDa and the accession number is A6QJ75. |
| Expression Region | 1-163 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
