You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295870 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant RHOC. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | RHOC (AAH07245, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL |
Tested applications | ELISA, IF, WB |
Clone Number | 1B7 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH07245 |
Detection limit for recombinant GST tagged RHOC is 3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to RHOC on HeLa cell. [antibody concentration 10 ug/ml].
RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in NIH/3T3.
RHOC monoclonal antibody (M06), clone 1B7. Western Blot analysis of RHOC expression in PC-12.
Western Blot detection against Immunogen (46.97 KDa).