RHOB Antibody

• Catalog Number: orb527036
• Category: Antibodies
• Description: RHOB Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human, Monkey, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human RHOB (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 22 kDa
• UniProt ID: P62745
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Rho-related GTP-binding protein RhoB; Rho cDNA clo
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB analysis of RHOB using anti-RHOB antibody.Lane 1:human HeLa cell; 2:rat brain tissue; 3:rat C6 cell; 4:mouse brain tissue; 5:monkey COS-7 cell.

IF analysis of RHOB using anti-RHOB antibody. RHOB was detected in an immunocytochemical section of U20S cells.

IHC analysis of RHOB using anti-RHOB antibody.RHOB was detected in paraffin-embedded section of human renal cancer tissue.

IHC analysis of RHOB using anti-RHOB antibody.RHOB was detected in paraffin-embedded section of human mammary cancer tissue.