RHOA monoclonal antibody (M05), clone 1C1

• Catalog Number: orb2295878
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant RHOA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C1
• Tested applications: ELISA, IHC-P, PLA, WB
• Reactivity: Human
• Isotype: IgG1 lambda
• Immunogen: RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
• NCBI: AAH01360
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RHOA is 3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to RHOA on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 5 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between MAPK8 and RHOA. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-RHOA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

RHOA monoclonal antibody (M05), clone 1C1 Western Blot analysis of RHOA expression in HeLa.

Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA monoclonal antibody (M05), clone 1C1. Lane 1: RHOA transfected lysate(21.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (46.97 KDa).