RHOA monoclonal antibody (M04J), clone 1B12

• Catalog Number: orb2295879
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant RHOA.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B12
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Lambda
• Immunogen: RHOA (AAH01360.1, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
• NCBI: AAH01360.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RHOA is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RHOA on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to RHOA on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 5 ug/ml].

RHOA monoclonal antibody (M04J), clone 1B12. Western Blot analysis of RHOA expression in U-2 OS.

Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA monoclonal antibody (M04J), clone 1B12. Lane 1: RHOA transfected lysate (Predicted MW: 21.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (46.97 KDa).