Rho GDI 1 Protein, Human, Recombinant (GST)

• Catalog Number: orb1977877
• Category: Proteins
• Description: Rho GDI 1 Protein, Human, Recombinant (GST) is expressed in E. coli.
• Tag: N-GST
• Purity: 98.00%
• MW: 50.1 kDa (predicted)
• UniProt ID: P52565
• Protein Sequence: AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
• Expression System: E. coli
• Biological Origin: Human
• Biological Activity: Rho GDI 1 Protein, Human, Recombinant (GST) is expressed in E. coli.
• Expression Region: 2-204 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.