You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291136 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant RHCG. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 5A4 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human, Rat |
Isotype | IgG2a Kappa |
Immunogen | RHCG (NP_057405, 418 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP |
NCBI | NP_057405 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
RHCG monoclonal antibody (M06), clone 5A4 Western Blot analysis of RHCG expression in PC-12.
Western Blot detection against Immunogen (32.56 KDa).