RHCG monoclonal antibody (M06), clone 5A4

• Catalog Number: orb2291136
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RHCG.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5A4
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: RHCG (NP_057405, 418 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
• NCBI: NP_057405
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]

RHCG monoclonal antibody (M06), clone 5A4 Western Blot analysis of RHCG expression in PC-12.

Western Blot detection against Immunogen (32.56 KDa).