You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292265 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant RGS13. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1B3 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2b Kappa |
Immunogen | RGS13 (NP_658912.1, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | NIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF |
NCBI | NP_658912.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoperoxidase of monoclonal antibody to RGS13 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Western Blot analysis of RGS13 expression in transfected 293T cell line by RGS13 monoclonal antibody (M06), clone 1B3. Lane 1: RGS13 transfected lysate (19.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).