RGS13 monoclonal antibody (M06), clone 1B3

• Catalog Number: orb2292265
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RGS13.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B3
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: RGS13 (NP_658912.1, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
• NCBI: NP_658912.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to RGS13 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot analysis of RGS13 expression in transfected 293T cell line by RGS13 monoclonal antibody (M06), clone 1B3. Lane 1: RGS13 transfected lysate (19.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).