RENT1/hUPF1 Antibody

• Catalog Number: orb334574
• Category: Antibodies
• Description: RENT1/hUPF1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Gallus
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 124345 MW
• UniProt ID: Q92900
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Regulator of nonsense transcripts 1;3.6.4.-;ATP-de
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of PC-3 cells using anti-RENT1/hUPF1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody.Lane 1:human HeLa cell; 2:human Raji cell; 3:human HepG2 cell;4:human SK-OV-3 cell;5:human PC-3 cell;6:human HEK293 cell;7:rat RH35 cell;8:mouse HEPA1-6 cell.

IF analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody.RENT1/hUPF1 was detected in immunocytochemical section of A431 cell.

IHC analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody. RENT1/hUPF1 was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody. RENT1/hUPF1 was detected in a paraffin-embedded section of rat intestine tissue.

IHC analysis of RENT1/hUPF1 using anti-RENT1/hUPF1 antibody. RENT1/hUPF1 was detected in a paraffin-embedded section of human intestinal cancer tissue.