Relaxin 1/RLN1 Antibody

• Catalog Number: orb402578
• Category: Antibodies
• Description: Relaxin 1/RLN1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Relaxin 1 (VAAKWKDDVIKLCGRELVRAQIAICGMSTWS).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 21 kDa
• UniProt ID: P04808
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Prorelaxin H1; Relaxin B chain; Relaxin A chain; R
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Relaxin 1 using anti-Relaxin 1 antibody.Lane 1:rat PC-12 cell.

IHC analysis of Relaxin 1 using anti-Relaxin 1 antibody.Relaxin 1 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of Relaxin 1 using anti-Relaxin 1 antibody.Relaxin 1 was detected in paraffin-embedded section of human prostatic cancer tissue.

IHC analysis of Relaxin 1 using anti-Relaxin 1 antibody.Relaxin 1 was detected in paraffin-embedded section of human colon cancer tissue.