You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402578 |
---|---|
Category | Antibodies |
Description | Relaxin 1/RLN1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human Relaxin 1 (VAAKWKDDVIKLCGRELVRAQIAICGMSTWS). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 21 kDa |
UniProt ID | P04808 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Prorelaxin H1; Relaxin B chain; Relaxin A chain; R Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Relaxin 1 using anti-Relaxin 1 antibody.Lane 1:rat PC-12 cell.
IHC analysis of Relaxin 1 using anti-Relaxin 1 antibody.Relaxin 1 was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of Relaxin 1 using anti-Relaxin 1 antibody.Relaxin 1 was detected in paraffin-embedded section of human prostatic cancer tissue.
IHC analysis of Relaxin 1 using anti-Relaxin 1 antibody.Relaxin 1 was detected in paraffin-embedded section of human colon cancer tissue.
Filter by Rating