Rel B/RELB Antibody

• Catalog Number: orb334531
• Category: Antibodies
• Description: Rel B/RELB Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Rel B (219-252aa RHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNA), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mosue Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 62134 MW
• UniProt ID: Q01201
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Transcription factor RelB;I-Rel;RELB;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Rel B using anti-Rel B antibody.Lane 1:HELA Cell;2:HUT Cell.