Regucalcin/RGN Antibody

• Catalog Number: orb413100
• Category: Antibodies
• Description: Regucalcin/RGN Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Regucalcin (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 33 kDa, 43 kDa
• UniProt ID: Q15493
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Regucalcin; RC; Gluconolactonase; GNL; Senescence
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Regucalcin using anti-Regucalcin antibody.Lane 1:rat liver tissue;2:mouse liver tissue;3:human SMMC-7721 cell.

IHC analysis of Regucalcin using anti-Regucalcin antibody.Regucalcin was detected in paraffin-embedded section of mouse liver tissue.

IHC analysis of Regucalcin using anti-Regucalcin antibody.Regucalcin was detected in paraffin-embedded section of rat kidney tissue.

IHC analysis of Regucalcin using anti-Regucalcin antibody.Regucalcin was detected in paraffin-embedded section of rat liver tissue.