You have no items in your shopping cart.
Cart summary
Recombinant Mouse IFN gamma
Catalog Number: orb623199
| Catalog Number | orb623199 |
|---|---|
| Category | Proteins |
| Description | IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Mouse IFN gamma Recombinant Protein is purified IFN gamma produced in yeast. |
| Form/Appearance | Lyophilized |
| MW | 15.5 kDa |
| Protein Sequence | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLK DNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLL PESSLRKRKRSRC (133) |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Application notes | The Rat APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Recombinant Mouse Interferon gamma (Ifng) [orb2666695]
Greater than 95% as determined by SDS-PAGE.
17.6 kDa
Yeast
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse IFN gamma protein [orb604180]
Greater than 90% as determined by SDS-PAGE.
19.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant mouse Interferon gamma (Ifng) [orb2658402]
Greater than 90% as determined by SDS-PAGE.
18.1 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 1
Mouse Il18 protein [orb604186]
Greater than 85% as determined by SDS-PAGE.
26.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant Mouse Interleukin-18 (Il18) (N36H,M85A,K87G,E90R,V91A,L94K) [orb1674441]
Greater than 90% as determined by SDS-PAGE.
24.0 kDa
E.coli
1 mg, 20 μg, 100 μg
