You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2061019 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Egl nine homolog 3 protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 31.2 kDa |
UniProt ID | Q91UZ4 |
Protein Sequence | PLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD |
Source | E.coli |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | 2610021G09Rik;AI505553;AI648162;Hif-p4h;Hif-p4h-3; Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
31.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
31.2 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
31.2 kDa | |
E.coli |
Filter by Rating