You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494679 |
---|---|
Category | Proteins |
Description | Chemokine (C-C motif) ligand 20 (CCL20) also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.Recombinant humanMIP-3 alpha/CCL20 produced in CHO cells is a polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhMIP-3 alpha/CCL20 has a molecular mass of 8kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 8 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIV RLLSKKVKNM |
Source | CHO |
Biological Activity | The EC50 value of humanMIP-3 alpha/CCL20 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR6 cells (human Ga15 and human CCR6 stably expressed in CHO-K1 cells) is less than 200 ng/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human MIP-3 alpha/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-3 alpha/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | MIP3α, MIP-3 alpha, CCL20 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating