You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494688 |
---|---|
Category | Proteins |
Description | LPSinduced CXC chemokine (LIX), also known as C-X-C motif chemokine 5(CXCL5), is a small cytokine belonging to the CXC chemokine family that is also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Rat LIX cDNA encodes a 130 aa residue precursor with a predicted 37 aa residue signal peptide and a 93 aa residue mature protein. Among human CXC chemokines, rat LIX is most closely related to human GCP-2 and ENA-78.LIX can signal through the CXCR2 receptor.Recombinant rat LIX/CXCL5 (88aa) produced in CHO cells is a polypeptide chain containing 88 amino acids. A fully biologically active molecule, rrLIX/CXCL5 (88aa) has a molecular mass of 9.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 9.6 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQK ILGSENKKTKRNALALVR |
Source | CHO |
Biological Activity | The EC50 value of rat LIX/CXCL5 (88aa) on Caˆ2+ mobilization assay in CHO-K1/G15/rCXCR2 cells (human Ga15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 3 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Rat LIX/CXCL5(88aa) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat LIX/CXCL5(88aa) should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | C-X-C motif chemokine 5, Small-inducible cytokine Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating