You have no items in your shopping cart.
Cart summary
Recombinant human Seleno protein P
Catalog Number: orb2060528
| Catalog Number | orb2060528 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Seleno protein P |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 42.6 kDa |
| UniProt ID | P49908 |
| Protein Sequence | ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN |
| Source | Yeast |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | selenoprotein P;selenoprotein P, plasma, 1;SELP;Se Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Recombinant human Seleno protein P [orb2062199]
Greater than 90% as determined by SDS-PAGE.
44.6 kDa
E.coli
1 mgRecombinant human Seleno protein P [orb2062200]
Greater than 90% as determined by SDS-PAGE.
44.6 kDa
E.coli
100 μgRecombinant human Seleno protein P [orb2060526]
Greater than 90% as determined by SDS-PAGE.
42.6 kDa
Yeast
20 μgRecombinant human Seleno protein P [orb2060527]
Greater than 90% as determined by SDS-PAGE.
42.6 kDa
Yeast
1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
