You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2060461 |
---|---|
Category | Proteins |
Description | Recombinant human Reticulocalbin-1 |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 37.7 kDa |
UniProt ID | Q15293 |
Protein Sequence | PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL |
Source | Yeast |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | epididymis secretory protein Li 84;HEL-S-84;PIG20; Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
37.7 kDa | |
Yeast |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
33.1 kDa | |
E.Coli |
Greater than 90% as determined by SDS-PAGE. | |
37.7 kDa | |
Yeast |
Filter by Rating