You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494751 |
---|---|
Category | Proteins |
Description | Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 15~20 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY A |
Source | CHO |
Biological Activity | ED50 < 1 μg/ml, measured in a proliferation assay using 3T3 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Epigen remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | EPG, Epithelial mitogen Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating