You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494753 |
---|---|
Category | Proteins |
Description | EGF Receptor,also known as ERBB, ERBB1 and HER1, is a type I transmembrane protein belonging to the tyrosine protein kinase family. It binds to a subset of EGF family ligands, including EGF, TGF-alpha, amphiregulin, EPGN, BTC, EREG and HBEGF. Ligand binding triggers receptor homo- or hetero-dimerization, which induces downstream kinase activation, tyrosine phosphorylation and cell signaling. EGF receptor signaling has been shown to regulate cell proliferation, differentiation, motility and apoptosis. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 95-115 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENL QIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHL GSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTC PPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGE FKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLE IIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQ VCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAH YIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSHHHHHH |
Source | CHO |
Biological Activity | ED50< 1 μg/ml, measured in a bioassay using 3T3 cells in the presence of 25 pg/ml human EGF. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human EGF Receptor, Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human EGF Receptor, His should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | ERBB, ERBB1, HER1 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating