Recombinant EGF R, His, Human

• Catalog Number: orb1494753
• Category: Proteins
• Description: EGF Receptor,also known as ERBB, ERBB1 and HER1, is a type I transmembrane protein belonging to the tyrosine protein kinase family. It binds to a subset of EGF family ligands, including EGF, TGF-alpha, amphiregulin, EPGN, BTC, EREG and HBEGF. Ligand binding triggers receptor homo- or hetero-dimerization, which induces downstream kinase activation, tyrosine phosphorylation and cell signaling. EGF receptor signaling has been shown to regulate cell proliferation, differentiation, motility and apoptosis.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 95-115 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENL QIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHL GSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTC PPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGE FKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLE IIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQ VCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAH YIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSHHHHHH
• Source: CHO
• Biological Activity: ED50< 1 μg/ml, measured in a bioassay using 3T3 cells in the presence of 25 pg/ml human EGF.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human EGF Receptor, Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human EGF Receptor, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: ERBB, ERBB1, HER1
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.