You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294476 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant RCC1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1C1 |
Tested applications | ELISA, IF, IP, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | RCC1 (AAH07300, 312 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS |
NCBI | AAH07300 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged RCC1 is 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to RCC1 on HeLa cell. [antibody concentration 15 ug/ml].
Immunoprecipitation of RCC1 transfected lysate using anti-RCC1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RCC1 MaxPab rabbit polyclonal antibody.
Western Blot analysis of RCC1 expression in transfected 293T cell line by RCC1 monoclonal antibody (M02), clone 1C1. Lane 1: RCC1 transfected lysate(45 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.73 KDa).