RCC1 monoclonal antibody (M01), clone 2F1

• Catalog Number: orb2294477
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RCC1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F1
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: RCC1 (AAH07300, 312 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
• NCBI: AAH07300
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to RCC1 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to RCC1 on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3 ug/ml].

RCC1 monoclonal antibody (M01), clone 2F1 Western Blot analysis of RCC1 expression in A-431.

Western Blot analysis of RCC1 expression in transfected 293T cell line by RCC1 monoclonal antibody (M01), clone 2F1. Lane 1: RCC1 transfected lysate(45 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).