RBM9 monoclonal antibody (M01), clone 4G3

• Catalog Number: orb2291320
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RBM9.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: RBM9 (AAH13115, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 4G3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH13115

Detection limit for recombinant GST tagged RBM9 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

RBM9 monoclonal antibody (M01), clone 4G3 Western Blot analysis of RBM9 expression in NIH/3T3.

Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody (M01), clone 4G3. Lane 1: RBM9 transfected lysate(40.4 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody (M01), clone 4G3 (Cat # orb2291320). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).