RBM5 monoclonal antibody (M01), clone 2B6

• Catalog Number: orb2291609
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RBM5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B6
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: RBM5 (AAH02957, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFED
• NCBI: AAH02957
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to RBM5 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to RBM5 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]

Western Blot analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody (M01), clone 2B6. Lane 1: RBM5 transfected lysate (61.5 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RBM5 over-expressed 293 cell line, cotransfected with RBM5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM5 monoclonal antibody (M01), clone 2B6 (Cat # orb2291609). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.73 KDa).