RBL2A antibody

• Catalog Number: orb325731
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBL2A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RBL2A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: RABL2A
• UniProt ID: Q9UBK7
• Protein Sequence: Synthetic peptide located within the following region: LSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAA
• NCBI: XP_006712280
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti RABL2A antibody, anti antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human MCF7 Whole Cell tissue using RBL2A antibody