You have no items in your shopping cart.
Cart summary
RANKL/TNFSF11/CD254 Protein, Mouse, Recombinant (His & SUMO)
Catalog Number: orb1976960
| Catalog Number | orb1976960 |
|---|---|
| Category | Proteins |
| Description | TNFSF11 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 43.9 kDa and the accession number is O35235. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 43.9 kDa (predicted) |
| UniProt ID | O35235 |
| Protein Sequence | YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | TNFSF11 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 43.9 kDa and the accession number is O35235. |
| Expression Region | 70-316 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
