RALB monoclonal antibody (M04), clone 4D1

• Catalog Number: orb2292280
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RALB.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4D1
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: RALB (AAH18163, 89 a.a. ~ 183 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE
• NCBI: AAH18163
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RALB is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to RALB on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Immunoprecipitation of RALB transfected lysate using anti-RALB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RALB MaxPab rabbit polyclonal antibody.

Western Blot analysis of RALB expression in transfected 293T cell line by RALB monoclonal antibody (M04), clone 4D1. Lane 1: RALB transfected lysate (23.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.08 KDa).