RAGE/AGER Antibody (monoclonal, 5C6C1)

• Catalog Number: orb1474866
• Category: Antibodies
• Description: RAGE/AGER Antibody (monoclonal, 5C6C1)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5C6C1
• Tested applications: FC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5 μg/ml, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Mouse, Rat Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 43 kDa
• UniProt ID: Q15109
• Storage: At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of mouse lung tissue.

IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue.

IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue.

Western blot analysis of RAGE/AGER using anti-RAGE/AGER antibody.

Flow Cytometry analysis of Jurkat cells using anti-RAGE/AGER antibody(Blue line).Isotype control antibody(Green line) was mouse IgG.Unlabelled sample(Red line) was also used as a control.