RAD51C monoclonal antibody (M01), clone 3F3-5C6

• Catalog Number: orb2292281
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant RAD51C.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F3-5C6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: RAD51C (AAH00667.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL
• NCBI: AAH00667.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RAD51C is approximately 0.1 ng/ml as a capture antibody.

RAD51C monoclonal antibody (M01), clone 3F3-5C6 Western Blot analysis of RAD51C expression in HeLa.

RAD51C monoclonal antibody (M01), clone 3F3-5C6. Western Blot analysis of RAD51C expression in 293.

Western Blot analysis of RAD51C expression in transfected 293T cell line by RAD51C monoclonal antibody (M01), clone 3F3-5C6. Lane 1: RAD51C transfected lysate (42.2 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RAD51C over-expressed 293 cell line, cotransfected with RAD51C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD51C monoclonal antibody (M01), clone 3F3-5C6 (Cat # orb2292281). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (40.48 KDa).