RAD18 monoclonal antibody (M01), clone 3H7

• Catalog Number: orb2290970
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RAD18.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3H7
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Kappa
• Immunogen: RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
• NCBI: NP_064550
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RAD18 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 25 ug/ml]

Immunoperoxidase of monoclonal antibody to RAD18 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]

RAD18 monoclonal antibody (M01), clone 3H7 Western Blot analysis of RAD18 expression in Hela S3 NE.

RAD18 monoclonal antibody (M01), clone 3H7. Western Blot analysis of RAD18 expression in PC-12.

Western Blot analysis of RAD18 expression in transfected 293T cell line by RAD18 monoclonal antibody (M01), clone 3H7. Lane 1: RAD18 transfected lysate(56.2 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RAD18 over-expressed 293 cell line, cotransfected with RAD18 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD18 monoclonal antibody (M01), clone 3H7 (Cat # orb2290970). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).