RACGAP1 monoclonal antibody (M01), clone 1G6

• Catalog Number: orb2291210
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RACGAP1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: RACGAP1 (AAH32754, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCD
• Tested applications: ELISA, WB
• Clone Number: 1G6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH32754

Detection limit for recombinant GST tagged RACGAP1 is approximately 0.3 ng/ml as a capture antibody.

RACGAP1 monoclonal antibody (M01), clone 1G6. Western Blot analysis of RACGAP1 expression in 293.

RACGAP1 monoclonal antibody (M01), clone 1G6. Western Blot analysis of RACGAP1 expression in Jurkat.

Western Blot detection against Immunogen (37.73 KDa).