RAC1 Protein, Human, Recombinant (His)

• Catalog Number: orb2276780
• Category: Proteins
• Description: RAC1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 24.6 kDa; 30 kDa, reducing conditions and the accession number is P63000.
• Tag: C-6xHis
• Purity: 85.00%
• MW: 24.6 kDa (predicted); 30 kDa (reducing conditions)
• UniProt ID: P63000
• Protein Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKC
• Expression System: P. pastoris (Yeast)
• Biological Origin: Human
• Biological Activity: RAC1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 24.6 kDa; 30 kDa, reducing conditions and the accession number is P63000.
• Expression Region: 1-189 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.