RAB7B monoclonal antibody (M01), clone 3B3

• Catalog Number: orb2290569
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RAB7B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B3
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
• NCBI: NP_796377
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RAB7B is approximately 0.03 ng/ml as a capture antibody.

Immunoprecipitation of RAB7B transfected lysate using anti-RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B MaxPab rabbit polyclonal antibody.

RAB7B monoclonal antibody (M01), clone 3B3. Western Blot analysis of RAB7B expression in A-431.

RAB7B monoclonal antibody (M01), clone 3B3. Western Blot analysis of RAB7B expression in human kidney.

Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M01), clone 3B3. Lane 1: RAB7B transfected lysate(22.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).