RAB3B monoclonal antibody (M01), clone 3F12

• Catalog Number: orb2292288
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RAB3B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F12
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: RAB3B (AAH05035, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
• NCBI: AAH05035
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RAB3B is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RAB3B on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to RAB3B on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]

RAB3B monoclonal antibody (M01), clone 3F12. Western Blot analysis of RAB3B expression in IMR-32.

Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M01), clone 3F12. Lane 1: RAB3B transfected lysate (24.758 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).