You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290774 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant RAB33B. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6F4 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | RAB33B (NP_112586, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM |
NCBI | NP_112586 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged RAB33B is approximately 0.03 ng/ml as a capture antibody.
RAB33B monoclonal antibody (M01), clone 6F4 Western Blot analysis of RAB33B expression in A-431.
RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in HeLa.
RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in NIH/3T3.
RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in PC-12.
Western Blot detection against Immunogen (35.64 KDa).