RAB33B monoclonal antibody (M01), clone 6F4

• Catalog Number: orb2290774
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RAB33B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6F4
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: RAB33B (NP_112586, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
• NCBI: NP_112586
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RAB33B is approximately 0.03 ng/ml as a capture antibody.

RAB33B monoclonal antibody (M01), clone 6F4 Western Blot analysis of RAB33B expression in A-431.

RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in HeLa.

RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in NIH/3T3.

RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in PC-12.

Western Blot detection against Immunogen (35.64 KDa).