You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292286 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant RAB27A. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | RAB27A (NP_004571, 122 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC |
Tested applications | ELISA, WB |
Clone Number | 4C1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004571 |
Detection limit for recombinant GST tagged RAB27A is approximately 0.03 ng/ml as a capture antibody.
RAB27A monoclonal antibody (M01), clone 4C1. Western Blot analysis of RAB27A expression in HL-60.
Western Blot detection against Immunogen (36.74 KDa).