RAB27A monoclonal antibody (M02), clone 1G7

• Catalog Number: orb2292285
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RAB27A.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: RAB27A (NP_004571, 122 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 1G7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004571

Detection limit for recombinant GST tagged RAB27A is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to RAB27A on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]

RAB27A monoclonal antibody (M02), clone 1G7 Western Blot analysis of RAB27A expression in HL-60.

Western Blot analysis of RAB27A expression in transfected 293T cell line by RAB27A monoclonal antibody (M02), clone 1G7. Lane 1: RAB27A transfected lysate (24.9 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RAB27A over-expressed 293 cell line, cotransfected with RAB27A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB27A monoclonal antibody (M02), clone 1G7 (Cat # orb2292285). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).