You have no items in your shopping cart.
Cart summary
Item 1 of 1
RAB1A monoclonal antibody (M07A), clone 3F10
Catalog Number: orb2292290
| Catalog Number | orb2292290 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant RAB1A. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgM Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In ascites fluid |
| Immunogen | RAB1A (NP_004152.1, 106 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | LQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC |
| Tested applications | ELISA, WB |
| Clone Number | 3F10 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_004152.1 |
Western Blot detection against Immunogen (36.63 KDa).
