You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2050232 |
---|---|
Category | Proteins |
Description | QPCT Recombinant Protein (Mouse) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 41.6 kDa |
UniProt ID | Q9CYK2 |
Protein Sequence | AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL |
Source | Mammalian Cells |
NCBI | NP_001303658 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | 5730422A13Rik;glutaminyl cyclase;glutaminyl-peptid Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
41.6 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
41.6 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
39.6 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
41.6 kDa | |
Mammalian Cells |
Greater than 90% as determined by SDS-PAGE. | |
41.6 kDa | |
E.coli |
Filter by Rating