You have no items in your shopping cart.
Cart summary
QPCT Protein, Mouse, Recombinant (His)
Catalog Number: orb1977241
| Catalog Number | orb1977241 |
|---|---|
| Category | Proteins |
| Description | Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. QPCT Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 39.6 kDa and the accession number is Q9CYK2. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 39.6 kDa (predicted) |
| UniProt ID | Q9CYK2 |
| Protein Sequence | AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Mouse |
| Biological Activity | Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. QPCT Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 39.6 kDa and the accession number is Q9CYK2. |
| Expression Region | 36-362 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
