QDPR monoclonal antibody (M02), clone M1

• Catalog Number: orb2292291
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant QDPR.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: QDPR (AAH00576, 1 a.a. ~ 244 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
• Tested applications: ELISA, WB
• Clone Number: M1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH00576

Detection limit for recombinant GST tagged QDPR is approximately 0.1 ng/ml as a capture antibody.

QDPR monoclonal antibody (M02), clone M1 Western Blot analysis of QDPR expression in HL-60.

Western Blot analysis of QDPR expression in transfected 293T cell line by QDPR monoclonal antibody (M02), clone M1. Lane 1: QDPR transfected lysate (25.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of QDPR over-expressed 293 cell line, cotransfected with QDPR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with QDPR monoclonal antibody (M02), clone M1 (Cat # orb2292291). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (52.58 KDa).