QARS monoclonal antibody (M01), clone 5F5

• Catalog Number: orb2292292
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant QARS.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5F5
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: QARS (NP_005042, 677 a.a. ~ 775 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
• NCBI: NP_005042
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged QARS is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Immunoprecipitation of QARS transfected lysate using anti-QARS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with QARS MaxPab rabbit polyclonal antibody.

QARS monoclonal antibody (M01), clone 5F5 Western Blot analysis of QARS expression in HeLa.

Western Blot analysis of QARS expression in transfected 293T cell line by QARS monoclonal antibody (M01), clone 5F5. Lane 1: QARS transfected lysate (87.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).