You have no items in your shopping cart.
Cart summary
PTX S1 Protein, Bordetella pertussis, Recombinant (His)
Catalog Number: orb1979703
| Catalog Number | orb1979703 |
|---|---|
| Category | Proteins |
| Description | S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD(+) into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their membrane receptors. PTX S1 Protein, Bordetella pertussis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.2 kDa and the accession number is P04977. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 28.2 kDa (predicted) |
| UniProt ID | P04977 |
| Protein Sequence | DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Bordetella pertussis |
| Biological Activity | S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD(+) into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their membrane receptors. PTX S1 Protein, Bordetella pertussis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.2 kDa and the accession number is P04977. |
| Expression Region | 35-269 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
