PTN monoclonal antibody (M01), clone 5C3

• Catalog Number: orb2292304
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PTN.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5C3
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: PTN (NP_002816, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK
• NCBI: NP_002816
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to PTN on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]

PTN monoclonal antibody (M01), clone 5C3 Western Blot analysis of PTN expression in Hela S3 NE.

Western Blot analysis of PTN expression in transfected 293T cell line by PTN monoclonal antibody (M01), clone 5C3. Lane 1: PTN transfected lysate (18.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).