PTK2B monoclonal antibody (M01), clone 1F9

• Catalog Number: orb2293105
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PTK2B.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PTK2B (AAH36651, 682 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA
• Tested applications: ELISA, IP, WB
• Clone Number: 1F9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH36651

Detection limit for recombinant GST tagged PTK2B is approximately 0.1 ng/ml as a capture antibody.

Immunoprecipitation of PTK2B transfected lysate using anti-PTK2B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTK2B MaxPab rabbit polyclonal antibody.

PTK2B monoclonal antibody (M01), clone 1F9 Western Blot analysis of PTK2B expression in K-562.

Western Blot analysis of PTK2B expression in transfected 293T cell line by PTK2B monoclonal antibody (M01), clone 1F9. Lane 1: PTK2B transfected lysate (115.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (46.53 KDa).