PTHLH monoclonal antibody (M01), clone 3H1-5G8

• Catalog Number: orb2292310
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant PTHLH.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3H1-5G8
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: PTHLH (AAH05961, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR
• NCBI: AAH05961
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PTHLH is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PTHLH on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PTHLH on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (44.99 KDa).