PSMA1 monoclonal antibody (M01), clone 1D9-1C7

• Catalog Number: orb2292322
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant PSMA1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D9-1C7
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: PSMA1 (AAH02577, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
• NCBI: AAH02577
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to PSMA1 on HeLa cell. [antibody concentration 60 ug/ml]

PSMA1 monoclonal antibody (M01), clone 1D9-1C7 Western Blot analysis of PSMA1 expression in HeLa.

Western Blot analysis of PSMA1 expression in transfected 293T cell line by PSMA1 monoclonal antibody (M01), clone 1D9-1C7. Lane 1: PSMA1 transfected lysate (30.2 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of PSMA1 over-expressed 293 cell line, cotransfected with PSMA1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMA1 monoclonal antibody (M01), clone 1D9-1C7 (Cat # orb2292322). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (54.67 KDa).