PSCA monoclonal antibody (M03), clone 5C2

• Catalog Number: orb2291922
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PSCA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5C2
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PSCA (NP_005663, 23 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
• NCBI: NP_005663
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PSCA is 0.1 ng/ml as a capture antibody.

Western Blot analysis of PSCA expression in transfected 293T cell line by PSCA monoclonal antibody (M03), clone 5C2. Lane 1: PSCA transfected lysate (12.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (33.77 KDa).