You have no items in your shopping cart.
Cart summary
PRSS1 Recombinant Protein (Rat)
Catalog Number: orb2053992
| Catalog Number | orb2053992 |
|---|---|
| Category | Proteins |
| Description | PRSS1 Recombinant Protein (Rat) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 39.6 kDa |
| UniProt ID | P00762 |
| Protein Sequence | IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN |
| Source | E.coli |
| NCBI | NP_036767 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | anionic trypsin I;anionic trypsin-1;pancreatic try Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Rat Prss1 protein [orb604331]
Greater than 85% as determined by SDS-PAGE.
27.2 kDa
E.coli
20 μg, 100 μg, 1 mgRat Prss1 protein [orb246418]
Greater than 90% as determined by SDS-PAGE.
39.6 kDa
E.coli
20 μg, 100 μg, 1 mgRat Prss1 protein [orb246776]
Greater than 90% as determined by SDS-PAGE.
25.6 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgPRSS1 Recombinant Protein (Rat) [orb2053991]
Greater than 90% as determined by SDS-PAGE.
39.6 kDa
E.coli
20 μgPRSS1 Recombinant Protein (Rat) [orb2053993]
Greater than 90% as determined by SDS-PAGE.
39.6 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
